PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00019.2.p
Common NameEUGRSUZ_J00019, LOC104420893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 345aa    MW: 36890.1 Da    PI: 9.765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00019.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38.2e-3966126262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +e  lkcprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Eucgr.J00019.2.p  66 PEPGLKCPRCDSTNTKFCYFNNYSLTQPRHFCKSCRRYWTRGGALRNVPVGGGCRRNKRSK 126
                       56789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3250115IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3270124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.76770124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWPQQAN QQSGASSEIP QLPLPPPPLP AGGGGTGSIR PGSMADRARL  60
AKVPQPEPGL KCPRCDSTNT KFCYFNNYSL TQPRHFCKSC RRYWTRGGAL RNVPVGGGCR  120
RNKRSKGSRS KSPVTTERQA ASGSTTSGSG VGVSSTAAAT DIIGHLVPPP SQLPFLPPLH  180
NLNDFISSDM GLNFGPGAQS QLAVARRGVV PDVEFQIGSS SGGGSQLLPN GLSDHQWRLN  240
QMHHQVQQFP FFANLQTPSY PLEGEVNASE LLRNKPLDHS TGIAHQMGST VKMEENQRLN  300
LSRNLNFSSG VSSSSNNNEQ FWGGNNNAWT DLSGFSSSSA SHLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00019.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030970.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X2
TrEMBLA0A059A8P60.0A0A059A8P6_EUCGR; Uncharacterized protein
STRINGVIT_13s0019g01410.t013e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.19e-39DNA binding with one finger 2.4